PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna23240.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NF-YB
Protein Properties Length: 638aa    MW: 69986.5 Da    PI: 6.6841
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna23240.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB173.81.8e-54494587194
                    NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86 
                              vreqdr+lPian+srimkk+lP+n+ki+kdak+tvqecvsefisfvtseasdkcq+ekrktingddllwa+atlGfedy+epl++y
  mrna23240.1-v1.0-hybrid 494 VREQDRYLPIANISRIMKKALPQNGKIAKDAKDTVQECVSEFISFVTSEASDKCQKEKRKTINGDDLLWAMATLGFEDYIEPLRIY 579
                              59************************************************************************************ PP

                    NF-YB  87 lkkyrele 94 
                              l++yre +
  mrna23240.1-v1.0-hybrid 580 LARYREGD 587
                              *****965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF567523.92E-241983IPR001544Aminotransferase class IV
SuperFamilySSF567523.92E-24117302IPR001544Aminotransferase class IV
Gene3DG3DSA:3.20.10.103.9E-24167346No hitNo description
PfamPF010631.2E-11205299IPR001544Aminotransferase class IV
Gene3DG3DSA:1.10.20.103.9E-52488596IPR009072Histone-fold
SuperFamilySSF471133.73E-38497621IPR009072Histone-fold
PfamPF008081.4E-27500564IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.9E-19528546No hitNo description
PROSITE patternPS006850531547IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.9E-19547565No hitNo description
PRINTSPR006152.9E-19566584No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003824Molecular Functioncatalytic activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 638 aa     Download sequence    Send to blast
MTTTPLRLLL TNGVVSDPST TPPVTTFLET HPGAYTTSRT HNNASLVLFW ERHLKRLTDS  60
VRILYNANPQ LLFGPNKTLV PLPSLAADSL LLRSRVGDLV NDSMNKVLPV ALEGRSDGEE  120
LSITTLVSGN LGRLGESGDL ELDRNGEALD VSIYVGIYVP PVFGVSRNGA QLAVVGRGRD  180
VAAAKYSDWV RIRKPLERLR PPSGTELLLS NDGDRILEGS VSNFFVVCRK EDNEAKEQTI  240
DCFEVQTAPI SDGVLPGIIR QLVIEVCLSK GIPFREVAPL WSEHEFWEEA FITSSLRLMQ  300
HAETVRAPSS WESLHGNSWK DISWKEKQFK KGPGMITTII QKEIMEKAVS EGYSLNHVGL  360
SDDLSLEYNN VIGFEFINTS GWMPDVQIPT SRRVTRWIPV TVLHFSPCSF LSRVKFLSSK  420
PGVSKSSLSS DFSTQNARNT NPPPSLLLPS LSSQLQGISV LFLIVIMAEV PTSPPGGNDS  480
GGEQSPQNGS SSSVREQDRY LPIANISRIM KKALPQNGKI AKDAKDTVQE CVSEFISFVT  540
SEASDKCQKE KRKTINGDDL LWAMATLGFE DYIEPLRIYL ARYREGDAKG SARGGEGSAK  600
GNPVGAMPGQ NSQFVHQPPL NYVNSQAQHL GSFYAKL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A7e-45493585193NF-YB
4awl_B8e-45493585294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A8e-45493585294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR2322734e-44KR232273.1 Vernicia fordii nuclear transcription factor Y subunit B-5 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004308809.10.0PREDICTED: uncharacterized protein LOC101303658 isoform X2
TrEMBLM5XCZ51e-179M5XCZ5_PRUPE; Uncharacterized protein
STRINGVIT_13s0019g03590.t011e-157(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF670633
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37060.37e-71nuclear factor Y, subunit B8